CacheBy
Atlas Antibodies Anti-SND1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SND1 Antibody

상품 한눈에 보기

인간 SND1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB에 적합. RNA-seq 데이터 기반 Orthogonal Validation 수행. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 인간, 마우스, 랫트 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA002529-100 Anti-SND1 Antibody, staphylococcal nuclease and tudor domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002529-25 Anti-SND1 Antibody, staphylococcal nuclease and tudor domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SND1 Antibody

Anti-SND1 Antibody

staphylococcal nuclease and tudor domain containing 1

  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human SND1

Alternative Gene Names

  • p100
  • TDRD11

Open Datasheet

Target Information

항목 내용
Target Protein staphylococcal nuclease and tudor domain containing 1
Target Gene SND1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000031173 (100%)
Mouse ENSMUSG00000001424 (100%)

Antigen Sequence

ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.