Atlas Antibodies Anti-SND1 Antibody

상품 한눈에 보기

인간 SND1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB에 적합. RNA-seq 데이터 기반 Orthogonal Validation 수행. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 인간, 마우스, 랫트 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA002529-100 Anti-SND1 Antibody, staphylococcal nuclease and tudor domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA002529-25 Anti-SND1 Antibody, staphylococcal nuclease and tudor domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

staphylococcal nuclease and tudor domain containing 1

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)

Polyclonal antibody against Human SND1

항목	내용
Target Protein	staphylococcal nuclease and tudor domain containing 1
Target Gene	SND1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000031173 (100%) Mouse ENSMUSG00000001424 (100%)

ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand