CacheBy
Atlas Antibodies Anti-SNCA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNCA Antibody

상품 한눈에 보기

인간 SNCA 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. RNA-seq 데이터 기반 정교한 Orthogonal 검증을 거쳤으며, Rabbit 유래 IgG 항체입니다. PrEST 항원으로 특이적 정제되어 높은 신뢰도의 단백질 발현 분석이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA005459-100 Anti-SNCA Antibody, synuclein, alpha (non A4 component of amyloid precursor) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005459-25 Anti-SNCA Antibody, synuclein, alpha (non A4 component of amyloid precursor) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNCA Antibody

Anti-SNCA Antibody

Target: synuclein, alpha (non A4 component of amyloid precursor)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Orthogonal Validation
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human SNCA

Alternative Gene Names: alpha-synuclein, NACP, PARK1, PARK4, PD1
Datasheet: Open Datasheet (PDF)


Specifications

항목 내용
Target Protein synuclein, alpha (non A4 component of amyloid precursor)
Target Gene SNCA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000025889 (93%), Rat ENSRNOG00000008656 (93%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.