Atlas Antibodies Anti-SNAPC4 Antibody

상품 한눈에 보기

Human SNAPC4 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합함. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 보유하며 안정적인 PBS/glycerol buffer에 보존됨.

카탈로그번호: HPA046627-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046627-100 Anti-SNAPC4 Antibody, small nuclear RNA activating complex, polypeptide 4, 190kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046627-25 Anti-SNAPC4 Antibody, small nuclear RNA activating complex, polypeptide 4, 190kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SNAPC4 Antibody

Anti-SNAPC4 Antibody

Target Protein: small nuclear RNA activating complex, polypeptide 4, 190kDa
Target Gene: SNAPC4

Recommended Applications

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human SNAPC4

Alternative Gene Names

FLJ13451, PTFalpha, SNAP190

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VRVPLLGSRLPYQPPALCSLRALSGLLLHKKALEHKATSLVVGGEAERPAGALQASLGLVRGQLQDNPAYLLLRARFLAAFTLPALLATLAPQGVRTTLSVPSRVGSESEDEDLLSELELA

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000018845	62%
Mouse	ENSMUSG00000036281	60%

Antibody Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand