CacheBy
Atlas Antibodies Anti-SNAPC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-SNAPC4 Antibody

상품 한눈에 보기

Human SNAPC4 단백질을 인식하는 토끼 폴리클로날 항체로, small nuclear RNA activating complex 연구에 적합. IHC 등 다양한 응용 가능. PrEST 항원을 이용해 친화 정제됨. PBS와 글리세롤 완충액에 보존됨.

카탈로그번호
HPA073243-xxx (2개 옵션)
브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073243-100 Anti-SNAPC4 Antibody, small nuclear RNA activating complex, polypeptide 4, 190kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073243-25 Anti-SNAPC4 Antibody, small nuclear RNA activating complex, polypeptide 4, 190kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SNAPC4 Antibody

Anti-SNAPC4 Antibody

Target: small nuclear RNA activating complex, polypeptide 4, 190 kDa
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human SNAPC4.

Alternative Gene Names

FLJ13451, PTFalpha, SNAP190

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein small nuclear RNA activating complex, polypeptide 4, 190 kDa
Target Gene SNAPC4
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000018845 (62%), Mouse ENSMUSG00000036281 (60%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:
VRVPLLGSRLPYQPPALCSLRALSGLLLHKKALEHKATSLVVGGEAERPAGALQASLGLVRGQLQDNPAYLLLRARFLAAFTLPALLATLAPQGVRTTLSVPSRVGSESEDEDLLSELELA

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-SNCA Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-SNAPC4 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-SNAPC3 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-SNAPIN Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.