
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EPRS Antibody
상품 한눈에 보기
Human EPRS(glutamyl-prolyl-tRNA synthetase)를 인식하는 Rabbit Polyclonal Antibody. IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제. 인간 반응성 검증 및 마우스, 랫트와 높은 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026490-100 Anti-EPRS Antibody, glutamyl-prolyl-tRNA synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026490-25 Anti-EPRS Antibody, glutamyl-prolyl-tRNA synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EPRS Antibody
Anti-EPRS Antibody
Target: glutamyl-prolyl-tRNA synthetase (EPRS)
Type: Polyclonal Antibody against Human EPRS
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human EPRS (glutamyl-prolyl-tRNA synthetase).
Alternative Gene Names
EARS, GLUPRORS, PARS, QARS, QPRS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glutamyl-prolyl-tRNA synthetase |
| Target Gene | EPRS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAIL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (86%), Rat (83%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



