Atlas Antibodies Anti-EPRS Antibody
상품 한눈에 보기
Human EPRS(glutamyl-prolyl-tRNA synthetase)를 인식하는 Rabbit Polyclonal Antibody. IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제. 인간 반응성 검증 및 마우스, 랫트와 높은 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EPRS Antibody
Target: glutamyl-prolyl-tRNA synthetase (EPRS)
Type: Polyclonal Antibody against Human EPRS
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human EPRS (glutamyl-prolyl-tRNA synthetase).
Alternative Gene Names
EARS, GLUPRORS, PARS, QARS, QPRS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glutamyl-prolyl-tRNA synthetase |
| Target Gene | EPRS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAIL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (86%), Rat (83%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.