CacheBy
Atlas Antibodies Anti-SLC44A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC44A2 Antibody

상품 한눈에 보기

인간 SLC44A2 단백질을 인식하는 토끼 폴리클로날 항체로, 콜린 수송 관련 단백질 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA003228-100 Anti-SLC44A2 Antibody, solute carrier family 44 (choline transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003228-25 Anti-SLC44A2 Antibody, solute carrier family 44 (choline transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC44A2 Antibody

Anti-SLC44A2 Antibody

Target: solute carrier family 44 (choline transporter), member 2
Alternative Gene Name: CTL2

Product Description

Polyclonal antibody against Human SLC44A2.

  • Immunohistochemistry (IHC)

Target Information

항목 내용
Target Protein solute carrier family 44 (choline transporter), member 2
Target Gene SLC44A2
Alternative Gene Name CTL2
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000031824 (87%), Mouse ENSMUSG00000057193 (83%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence NENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRYLTYLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVE

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.