CacheBy
Atlas Antibodies Anti-SLC43A3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC43A3 Antibody

상품 한눈에 보기

Human SLC43A3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC와 WB 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되어 신뢰성 높은 연구용으로 사용 가능합니다.

카탈로그번호
HPA077244-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077244-100 Anti-SLC43A3 Antibody, solute carrier family 43 member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077244-25 Anti-SLC43A3 Antibody, solute carrier family 43 member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC43A3 Antibody

Anti-SLC43A3 Antibody

Target: solute carrier family 43, member 3 (SLC43A3)

  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Product Description

Polyclonal antibody against human SLC43A3.

Alternative Gene Names

DKFZp762A227, Eeg1, FOAP-13, PRO1659, SEEEG-1

Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 43, member 3
Target Gene SLC43A3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000061768 (63%), Mouse ENSMUSG00000027074 (60%)

Antigen Sequence:

SFIFISVCSTWHVARTFLLMPRGHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.