CacheBy
Atlas Antibodies Anti-SLC43A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC43A1 Antibody

상품 한눈에 보기

Human SLC43A1 단백질을 인식하는 Rabbit Polyclonal Antibody. WB 및 IHC에 적합. PrEST 항원을 이용해 Affinity purification 수행. Human 반응성 검증 완료. Glycerol/PBS buffer에 sodium azide 보존제 포함.

카탈로그번호
HPA018813-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018813-100 Anti-SLC43A1 Antibody, solute carrier family 43 (amino acid system L transporter), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018813-25 Anti-SLC43A1 Antibody, solute carrier family 43 (amino acid system L transporter), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC43A1 Antibody

Anti-SLC43A1 Antibody

Target: solute carrier family 43 (amino acid system L transporter), member 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human SLC43A1.


Alternative Gene Names

PB39, POV1, R00504

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 43 (amino acid system L transporter), member 1
Target Gene SLC43A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000027075 (67%), Rat ENSRNOG00000008243 (65%)

Antigen Sequence:
MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQ


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.