CacheBy
Atlas Antibodies Anti-SLC35E1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC35E1 Antibody

상품 한눈에 보기

Human SLC35E1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit host 기반 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증된 고품질 연구용 항체.

카탈로그번호
HPA062214-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062214-100 Anti-SLC35E1 Antibody, solute carrier family 35, member E1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062214-25 Anti-SLC35E1 Antibody, solute carrier family 35, member E1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC35E1 Antibody

Anti-SLC35E1 Antibody

Target: solute carrier family 35, member E1
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SLC35E1.

Alternative Gene Names

  • FLJ14251

Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 35, member E1
Target Gene SLC35E1
Verified Species Reactivity Human
Interspecies Identity Mouse (76%), Rat (76%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.