CacheBy
Atlas Antibodies Anti-SLC34A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC34A1 Antibody

상품 한눈에 보기

Human SLC34A1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. PBS/glycerol buffer에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA077175-100 Anti-SLC34A1 Antibody, solute carrier family 34 member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077175-25 Anti-SLC34A1 Antibody, solute carrier family 34 member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC34A1 Antibody

Anti-SLC34A1 Antibody

Target: solute carrier family 34 (type II sodium/phosphate cotransporter), member 1
Product Type: Polyclonal antibody against Human SLC34A1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Rabbit polyclonal antibody targeting the human SLC34A1 protein, a member of the type II sodium/phosphate cotransporter family.


Alternative Gene Names

NAPI-3, NPT2, NPTIIa, SLC11, SLC17A2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 34 (type II sodium/phosphate cotransporter), member 1
Target Gene SLC34A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQA
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000015262 (73%), Mouse ENSMUSG00000021490 (72%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.