CacheBy
Atlas Antibodies Anti-SLC31A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC31A2 Antibody

상품 한눈에 보기

Rabbit polyclonal antibody against human SLC31A2 (copper transporter). Suitable for IHC and ICC applications. Affinity purified using PrEST antigen. Supplied in 40% glycerol/PBS with sodium azide preservative. Verified reactivity with human protein.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA014861-100 Anti-SLC31A2 Antibody, solute carrier family 31 (copper transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014861-25 Anti-SLC31A2 Antibody, solute carrier family 31 (copper transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC31A2 Antibody

Anti-SLC31A2 Antibody

Target: solute carrier family 31 (copper transporter), member 2
Product Type: Polyclonal Antibody against Human SLC31A2


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Alternative Gene Names

COPT2, CTR2, hCTR2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 31 (copper transporter), member 2
Target Gene SLC31A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000013631 (62%), Mouse ENSMUSG00000066152 (58%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.