
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC31A2 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody against human SLC31A2 (copper transporter). Suitable for IHC and ICC applications. Affinity purified using PrEST antigen. Supplied in 40% glycerol/PBS with sodium azide preservative. Verified reactivity with human protein.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA014861-100 Anti-SLC31A2 Antibody, solute carrier family 31 (copper transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014861-25 Anti-SLC31A2 Antibody, solute carrier family 31 (copper transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC31A2 Antibody
Anti-SLC31A2 Antibody
Target: solute carrier family 31 (copper transporter), member 2
Product Type: Polyclonal Antibody against Human SLC31A2
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Alternative Gene Names
COPT2, CTR2, hCTR2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 31 (copper transporter), member 2 |
| Target Gene | SLC31A2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000013631 (62%), Mouse ENSMUSG00000066152 (58%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.


