
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC34A1 Antibody
상품 한눈에 보기
Human SLC34A1 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 Affinity purification으로 높은 특이성과 재현성을 제공합니다. PBS/glycerol buffer에 보존되어 안정성이 우수합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA051255-100 Anti-SLC34A1 Antibody, solute carrier family 34 (type II sodium/phosphate contransporter), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051255-25 Anti-SLC34A1 Antibody, solute carrier family 34 (type II sodium/phosphate contransporter), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC34A1 Antibody
Anti-SLC34A1 Antibody
Target: solute carrier family 34 (type II sodium/phosphate cotransporter), member 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human SLC34A1
Alternative Gene Names
NAPI-3, NPT2, NPTIIa, SLC11, SLC17A2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Solute carrier family 34 (type II sodium/phosphate cotransporter), member 1 |
| Target Gene | SLC34A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQA |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000015262 (73%), Mouse ENSMUSG00000021490 (72%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



