
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC25A12 Antibody
상품 한눈에 보기
Human SLC25A12 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Aralar로도 알려진 SLC25A12 단백질의 발현을 검증할 수 있으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human, Mouse, Rat 반응성 확인됨.
- 카탈로그번호
- HPA035334-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035334-100 Anti-SLC25A12 Antibody, solute carrier family 25 (aspartate/glutamate carrier), member 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035334-25 Anti-SLC25A12 Antibody, solute carrier family 25 (aspartate/glutamate carrier), member 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC25A12 Antibody
Anti-SLC25A12 Antibody
solute carrier family 25 (aspartate/glutamate carrier), member 12
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Independent validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human SLC25A12
Alternative Gene Names
- Aralar
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 25 (aspartate/glutamate carrier), member 12 |
| Target Gene | SLC25A12 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMV |
Species Reactivity
- Verified Species: Human, Mouse, Rat
- Interspecies Identity:
- Rat ENSRNOG00000022922 (97%)
- Mouse ENSMUSG00000027010 (97%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



