CacheBy
Atlas Antibodies Anti-SLC25A12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A12 Antibody

상품 한눈에 보기

Human SLC25A12 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Aralar로도 알려진 SLC25A12 단백질의 발현을 검증할 수 있으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human, Mouse, Rat 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035334-100 Anti-SLC25A12 Antibody, solute carrier family 25 (aspartate/glutamate carrier), member 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035334-25 Anti-SLC25A12 Antibody, solute carrier family 25 (aspartate/glutamate carrier), member 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A12 Antibody

Anti-SLC25A12 Antibody

solute carrier family 25 (aspartate/glutamate carrier), member 12


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent validation)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human SLC25A12


Alternative Gene Names

  • Aralar

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 25 (aspartate/glutamate carrier), member 12
Target Gene SLC25A12
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMV

Species Reactivity

  • Verified Species: Human, Mouse, Rat
  • Interspecies Identity:
    • Rat ENSRNOG00000022922 (97%)
    • Mouse ENSMUSG00000027010 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.