Atlas Antibodies Anti-SLC1A5 Antibody

상품 한눈에 보기

Human SLC1A5 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현), ICC에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대한 검증 완료, 쥐 및 생쥐와 66% 서열 유사성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035240-100 Anti-SLC1A5 Antibody, solute carrier family 1 (neutral amino acid transporter), member 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035240-25 Anti-SLC1A5 Antibody, solute carrier family 1 (neutral amino acid transporter), member 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: solute carrier family 1 (neutral amino acid transporter), member 5
Supplier: Atlas Antibodies

Recombinant expression validation: WB에서 타깃 단백질 과발현을 이용한 재조합 발현 검증 완료.

Polyclonal antibody against Human SLC1A5

AAAT, ASCT2, M7V1, RDRC

항목	내용
Target Protein	solute carrier family 1 (neutral amino acid transporter), member 5
Target Gene	SLC1A5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000015948 (66%), Mouse ENSMUSG00000001918 (66%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand