CacheBy
Atlas Antibodies Anti-SLC1A6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC1A6 Antibody

상품 한눈에 보기

Human SLC1A6 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 ICC에 적합함. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증됨. EAAT4로도 알려진 SLC1A6에 특이적이며, 고순도 Affinity 정제 방식으로 제조됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA044066-100 Anti-SLC1A6 Antibody, solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044066-25 Anti-SLC1A6 Antibody, solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC1A6 Antibody

Anti-SLC1A6 Antibody

solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6

  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human SLC1A6

Alternative Gene Names

EAAT4

Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
Target Gene SLC1A6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000005357 (85%), Rat ENSRNOG00000007509 (82%)

Antigen Sequence:

KQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.