CacheBy
Atlas Antibodies Anti-SLC22A12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC22A12 Antibody

상품 한눈에 보기

Human SLC22A12 단백질을 인식하는 rabbit polyclonal 항체로, URAT1 단백질 검출에 사용됩니다. IHC 등에서 RNA-seq 데이터와의 Orthogonal validation 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA024575-100 Anti-SLC22A12 Antibody, solute carrier family 22 (organic anion/urate transporter), member 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024575-25 Anti-SLC22A12 Antibody, solute carrier family 22 (organic anion/urate transporter), member 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC22A12 Antibody

Anti-SLC22A12 Antibody

solute carrier family 22 (organic anion/urate transporter), member 12


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLC22A12


Alternative Gene Names

OAT4L, RST, URAT1

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 22 (organic anion/urate transporter), member 12
Target Gene SLC22A12
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCI
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity to orthologs: Mouse (67%), Rat (64%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.