CacheBy
Atlas Antibodies Anti-SLC14A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC14A1 Antibody

상품 한눈에 보기

Human SLC14A1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형 항체입니다. WB 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되어 연구용으로 신뢰성 높습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA077233-100 Anti-SLC14A1 Antibody, solute carrier family 14 member 1 (Kidd blood group) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077233-25 Anti-SLC14A1 Antibody, solute carrier family 14 member 1 (Kidd blood group) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC14A1 Antibody

Anti-SLC14A1 Antibody

solute carrier family 14 (urea transporter), member 1 (Kidd blood group)


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human SLC14A1


Alternative Gene Names

HsT1341, JK, RACH1, RACH2

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 14 (urea transporter), member 1 (Kidd blood group)
Target Gene SLC14A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MNGRSLIGGAGDARHGPVWKDPFGTKAGDAARRGIARLSLALADGSQEQE
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000059336 (60%)
Rat ENSRNOG00000011680 (32%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative.
Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.