
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC13A5 Antibody
상품 한눈에 보기
Human SLC13A5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. PrEST 항원으로 친화 정제되었으며 PBS/glycerol 버퍼에 보존제 포함. 인간 반응성 확인 및 설치류와 높은 서열 유사성.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA044343-100 Anti-SLC13A5 Antibody, solute carrier family 13 (sodium-dependent citrate transporter), member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044343-25 Anti-SLC13A5 Antibody, solute carrier family 13 (sodium-dependent citrate transporter), member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC13A5 Antibody
Anti-SLC13A5 Antibody
Target: solute carrier family 13 (sodium-dependent citrate transporter), member 5
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against human SLC13A5.
Alternative Gene Names
- NACT
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 13 (sodium-dependent citrate transporter), member 5 |
| Target Gene | SLC13A5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000014870 (92%) Mouse ENSMUSG00000020805 (92%) |
Antigen Sequence:
SQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPW
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



