CacheBy
Atlas Antibodies Anti-SLC13A5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC13A5 Antibody

상품 한눈에 보기

Human SLC13A5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. PrEST 항원으로 친화 정제되었으며 PBS/glycerol 버퍼에 보존제 포함. 인간 반응성 확인 및 설치류와 높은 서열 유사성.

카탈로그번호
HPA044343-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044343-100 Anti-SLC13A5 Antibody, solute carrier family 13 (sodium-dependent citrate transporter), member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044343-25 Anti-SLC13A5 Antibody, solute carrier family 13 (sodium-dependent citrate transporter), member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC13A5 Antibody

Anti-SLC13A5 Antibody

Target: solute carrier family 13 (sodium-dependent citrate transporter), member 5
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human SLC13A5.

Alternative Gene Names

  • NACT

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein solute carrier family 13 (sodium-dependent citrate transporter), member 5
Target Gene SLC13A5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014870 (92%)
Mouse ENSMUSG00000020805 (92%)

Antigen Sequence:
SQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPW

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.