CacheBy
Atlas Antibodies Anti-SLC15A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC15A1 Antibody

상품 한눈에 보기

Human SLC15A1 단백질을 인식하는 Rabbit Polyclonal IgG 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Mouse, Rat과도 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA002827-100 Anti-SLC15A1 Antibody, solute carrier family 15 (oligopeptide transporter), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002827-25 Anti-SLC15A1 Antibody, solute carrier family 15 (oligopeptide transporter), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC15A1 Antibody

Anti-SLC15A1 Antibody

Target: solute carrier family 15 (oligopeptide transporter), member 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC15A1.


Alternative Gene Names

HPECT1, HPEPT1, PEPT1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 15 (oligopeptide transporter), member 1
Target Gene SLC15A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (74%), Rat (72%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

DKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNA

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.