Atlas Antibodies Anti-SLC13A2 Antibody

상품 한눈에 보기

휴먼 SLC13A2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등에서 정량적 단백질 발현 분석에 적합. RNA-seq 데이터 기반 직교 검증 완료. 친화 정제된 고품질 항체로 다양한 조직 연구에 활용 가능.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기

Atlas Antibodies HPA014963-100 Anti-SLC13A2 Antibody, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA014963-25 Anti-SLC13A2 Antibody, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC13A2 Antibody

Anti-SLC13A2 Antibody

Target: solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC13A2

Alternative Gene Names

NaDC-1

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2
Target Gene	SLC13A2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGTAPNLVLQGQINSLFPQNGNVV
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000010337 (71%), Mouse ENSMUSG00000001095 (67%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)