CacheBy
Atlas Antibodies Anti-SKIV2L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SKIV2L Antibody

상품 한눈에 보기

Human SKIV2L 단백질을 인식하는 Rabbit Polyclonal 항체로, Ski2-like RNA helicase 연구에 적합. Affinity purification으로 높은 특이성과 재현성 제공. Human에 검증되었으며, Mouse 및 Rat과 높은 서열 유사성 보유. ICC 등 다양한 응용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047122-100 Anti-SKIV2L Antibody, Ski2 like RNA helicase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047122-25 Anti-SKIV2L Antibody, Ski2 like RNA helicase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SKIV2L Antibody

Anti-SKIV2L Antibody

Target Information

  • Target Protein: Ski2 like RNA helicase
  • Target Gene: SKIV2L
  • Alternative Gene Names: 170A, DDX13, HLP, SKI2W, SKIV2, SKIV2L1

Product Description

Polyclonal Antibody against Human SKIV2L

Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000000421 (97%)
  • Mouse ENSMUSG00000040356 (97%)

Clonality and Host

  • Clonality: Polyclonal
  • Isotype: IgG
  • Host: Rabbit

Buffer Composition

Purification Method

Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.