CacheBy
Atlas Antibodies Anti-SKIL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SKIL Antibody

상품 한눈에 보기

Human SKIL 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 Affinity 정제 방식으로 높은 특이성과 재현성 제공. Human에 대해 검증된 반응성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014233-100 Anti-SKIL Antibody, SKI like proto-oncogene 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014233-25 Anti-SKIL Antibody, SKI like proto-oncogene 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SKIL Antibody

Anti-SKIL Antibody

Target: SKI-like proto-oncogene (SKIL)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SKIL.


Alternative Gene Names

SNO, SnoA, SnoN

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein SKI-like proto-oncogene
Target Gene SKIL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000027660 (88%), Rat ENSRNOG00000009899 (87%)

Antigen Sequence

SPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQ


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.