CacheBy
Atlas Antibodies Anti-SKIV2L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SKIV2L Antibody

상품 한눈에 보기

인간 SKIV2L 단백질을 인식하는 토끼 폴리클로날 항체. RNA 헬리케이스 연구용으로 적합하며, 97% 이상의 설치류 상동성. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

카탈로그번호
HPA051959-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051959-100 Anti-SKIV2L Antibody, superkiller viralicidic activity 2-like (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051959-25 Anti-SKIV2L Antibody, superkiller viralicidic activity 2-like (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SKIV2L Antibody

Anti-SKIV2L Antibody

Target Information

  • Target Protein: Ski2 like RNA helicase
  • Target Gene: SKIV2L
  • Alternative Gene Names: 170A, DDX13, HLP, SKI2W, SKIV2, SKIV2L1

Product Description

Polyclonal antibody against human SKIV2L, suitable for detecting Ski2-like RNA helicase.

  • ICC (Immunocytochemistry)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat: ENSRNOG00000000421 (97%)
  • Mouse: ENSMUSG00000040356 (97%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.