Thermo Fisher Scientific UPF1 Monoclonal Antibody (11E7)
UPF1 단백질을 인식하는 mouse monoclonal antibody로 Western blot, IHC, ICC/IF에 적합. 인간, 생쥐, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 비결합형 제형. NMD 관련 연구용으로 사용.
- 카탈로그번호
- MA549176
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific UPF1 Monoclonal Antibody (11E7)
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 11E7 |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578–614 aa: NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | Store at 4°C short term. For long term, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_3074834 |
Product Specific Information
- Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
- Immunogen sequence is identical to the related mouse and rat sequences.
Target Information
Upf1 is an active component of nonsense-mediated decay (NMD), an mRNA surveillance mechanism in eukaryotic cells that degrades mRNAs containing premature termination codons.
It functions as an ATP-dependent RNA helicase located in the cytoplasm and is a component of cytoplasmic P-bodies.
Upf1 phosphorylation mediates translation repression associated with NMD, enabling mRNA accessibility to the NMD machinery.
Other active components of NMD include Upf2 and Upf3, which exhibit perinuclear and nucleocytoplasmic localization, respectively.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.