Thermo Fisher Scientific RAB11A Monoclonal Antibody (4H9)
RAB11A 단백질을 인식하는 Mouse IgG2b 단클론 항체. Western blot, IHC, ICC/IF, Flow Cytometry에 사용 가능. Human, Mouse, Rat 반응성. 동결건조 형태로 제공되며, 항원 친화 크로마토그래피로 정제됨. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific RAB11A Monoclonal Antibody (4H9)
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.25–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 4H9 |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171–211aa: EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_3074855 |
Product Specific Information
- Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
- Immunogen sequence is identical to the related mouse and rat sequences.
Target Information
Rab11A is a member of the YPT-1 subfamily of Ras-related GTP-binding proteins. Rab11A mRNA has been detected in a variety of tissues including brain, testis, spleen, heart, and gastrointestinal mucosa. In the gastric fundus, the Rab11A protein is expressed in parietal cell tubulovesicular membranes. Expression occurs in discrete epithelial cell populations where it localizes to apical vesicular populations.
Recent studies have shown Rab11A is essential for resecretion of alpha-synuclein out of neuronal cells via endosome recycling and is required for exocytosis of discoidal/fusiform vesicles of bladder umbrella cells. Rab11A is also implicated in biogenesis of Birbeck granules and endosomal activation of the PI3K/AKT signaling pathway via G beta gamma trafficking.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.