CacheBy
Thermo Fisher Scientific SMAD1 Monoclonal Antibody (2A1)
원본

Thermo Fisher Scientific SMAD1 Monoclonal Antibody (2A1)

상품 한눈에 보기

SMAD1 단백질을 인식하는 Thermo Fisher Scientific의 단클론 항체(2A1). Western blot 및 ELISA에 적합하며, Human, Mouse, Rat 시료에 반응. 비결합형 액상 형태로 제공되며, -20°C에서 보관. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 12:07
Thermo Fisher Scientific H00004086-M04A SMAD1 Monoclonal Antibody (2A1) 200 ul pk판매 단위 pk ·
재고 확인 필요
518,100원VAT 포함 569,910원

Thermo Fisher Scientific · Thermo Fisher Scientific SMAD1 Monoclonal Antibody (2A1)

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 1:500–1:1,000
ELISA 10 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2b, kappa
Class Monoclonal
Type Antibody
Clone 2A1
Immunogen SMAD1 (AAH01878.1, 1–465 a.a.) full-length recombinant protein with GST tag (GST tag MW: 26 kDa)
Conjugate Unconjugated
Form Liquid
Concentration See Label
Storage Buffer Ascites
Contains No preservative
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Ambient (domestic); Wet ice (international)

Product Specific Information

Protein Sequence:

MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKR VESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDV TSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS

Target Information

The protein encoded by this gene belongs to the SMAD family, which includes proteins similar to Drosophila Mad and C. elegans Sma. SMAD proteins act as signal transducers and transcriptional modulators mediating multiple signaling pathways. SMAD1 mediates BMP (Bone Morphogenetic Protein) signaling, which regulates cell growth, apoptosis, morphogenesis, development, and immune responses. Upon BMP ligand binding, SMAD1 is phosphorylated and forms a complex with SMAD4 to regulate transcription. It is also targeted by SMAD-specific E3 ubiquitin ligases (SMURF1, SMURF2) for ubiquitination and proteasomal degradation. Alternative splicing variants encoding the same protein have been observed.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.