CacheBy
Atlas Antibodies Anti-ELOC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ELOC Antibody

상품 한눈에 보기

Human ELOC(Elongin C) 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되었으며 ICC 등 다양한 응용에 적합. Human, Rat, Mouse에서 높은 반응성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA078113-100 Anti-ELOC Antibody, elongin C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA078113-25 Anti-ELOC Antibody, elongin C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ELOC Antibody

Anti-ELOC Antibody

Target Information

  • Target Protein: elongin C
  • Target Gene: ELOC
  • Alternative Gene Names: SIII, TCEB1

이미지 아이콘 설명: Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human ELOC

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000031730 (100%)
  • Mouse ENSMUSG00000079658 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.