CacheBy
Atlas Antibodies Anti-ELOA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ELOA2 Antibody

상품 한눈에 보기

Human ELOA2 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. PBS와 glycerol buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053158-100 Anti-ELOA2 Antibody, elongin A3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053158-25 Anti-ELOA2 Antibody, elongin A3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ELOA2 Antibody

Anti-ELOA2 Antibody

Overview

Polyclonal Antibody against Human ELOA2 (elongin A2)

  • Immunohistochemistry (IHC)

Product Description

This antibody is a polyclonal IgG raised in rabbit against the human ELOA2 protein. It is affinity purified using the PrEST antigen as the affinity ligand.

Alternative Gene Names

  • HsT832
  • TCEB3B
  • TCEB3L

Target Information

항목 내용
Target Protein elongin A2
Target Gene ELOA2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000010902 (41%)
Mouse ENSMUSG00000028668 (38%)

Antigen Sequence:
GHKSSRQEKRPLCAQGDWHSPTLIREKSCGACLREETPRMPSWASARDRQPSDFKTDKEGGQAGSGQRVPALEEAPDSHQ

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.