CacheBy
Atlas Antibodies Anti-ELOF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ELOF1 Antibody

상품 한눈에 보기

Human ELOF1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 분석에 적합함. Rabbit에서 생산된 IgG 타입이며, PrEST 항원으로 친화 정제됨. 높은 종 간 항원 동일성을 보여 신뢰도 높은 검출 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045606-100 Anti-ELOF1 Antibody, elongation factor 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045606-25 Anti-ELOF1 Antibody, elongation factor 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ELOF1 Antibody

Anti-ELOF1 Antibody

Target: elongation factor 1 homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human ELOF1

Alternative Gene Names

  • ELF1
  • MGC4549

Open Datasheet

Target Information

항목 내용
Target Protein elongation factor 1 homolog (S. cerevisiae)
Target Gene ELOF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000013822 (100%), Rat ENSRNOG00000014284 (100%)

Antigen Sequence:
KMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDW

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.