
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ELF3 Antibody
상품 한눈에 보기
인간 ELF3 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반의 orthogonal validation 수행. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 다양한 조직 및 세포주에서 ELF3 단백질 발현 연구에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA003479-100 Anti-ELF3 Antibody, E74-like factor 3 (ets domain transcription factor, epithelial-specific ) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003479-25 Anti-ELF3 Antibody, E74-like factor 3 (ets domain transcription factor, epithelial-specific ) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ELF3 Antibody
Anti-ELF3 Antibody
E74-like factor 3 (ETS domain transcription factor, epithelial-specific)
Recommended Applications
- IHC Orthogonal Validation: Protein expression validated by comparison to RNA-seq data of corresponding target in tissues with high and low expression.
- WB Orthogonal Validation: Protein expression validated by comparison to RNA-seq data of corresponding target in cell lines with high and low expression.
Product Description
Polyclonal antibody against Human ELF3
Alternative Gene Names
EPR-1, ERT, ESE-1, ESX
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | E74-like factor 3 (ETS domain transcription factor, epithelial-specific) |
| Target Gene | ELF3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000003051 (86%), Rat ENSRNOG00000006330 (74%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
ATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMA제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



