CacheBy
Atlas Antibodies Anti-ELAVL4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ELAVL4 Antibody

상품 한눈에 보기

Human ELAVL4 단백질을 인식하는 Rabbit Polyclonal 항체로, ELAV like RNA binding protein 4 검출에 사용됩니다. 높은 종간 반응성(인간, 생쥐, 랫드)과 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043047-100 Anti-ELAVL4 Antibody, ELAV like RNA binding protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043047-25 Anti-ELAVL4 Antibody, ELAV like RNA binding protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ELAVL4 Antibody

Anti-ELAVL4 Antibody

Target: ELAV like RNA binding protein 4 (ELAVL4)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ELAVL4, also known as ELAV like RNA binding protein 4.


Alternative Gene Names

  • HUD
  • PNEM

Open Datasheet


Target Information

항목 내용
Target Protein ELAV like RNA binding protein 4
Target Gene ELAVL4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000028546) – 98%
  • Rat (ENSRNOG00000023601) – 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.