원본

Atlas Antibodies Anti-ELFN1 Antibody

상품 한눈에 보기

Human ELFN1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity Purified 제품입니다. ICC 등 다양한 응용에 적합하며, 고순도 및 재현성 높은 실험 결과를 제공합니다. 보존용으로 40% glycerol과 PBS(pH 7.2) 사용.

카탈로그번호: HPA066382-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA066382-100 Anti-ELFN1 Antibody, extracellular leucine rich repeat and fibronectin type III domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA066382-25 Anti-ELFN1 Antibody, extracellular leucine rich repeat and fibronectin type III domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ELFN1 Antibody

Anti-ELFN1 Antibody

Target: extracellular leucine rich repeat and fibronectin type III domain containing 1 (ELFN1)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies

Recommended Applications

ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human ELFN1

Alternative Gene Names

PPP1R28

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	extracellular leucine rich repeat and fibronectin type III domain containing 1
Target Gene	ELFN1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000022767 (81%), Mouse ENSMUSG00000048988 (81%)

Antigen Sequence:

PSDMPCADDECFSGDGTTPLVALPTLATQAEARPLIKVKQLTQNSATITVQLPSPFHRMYTLEHFNNSKASTVSRLTKAQEEIRLTNLF

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.