Atlas Antibodies Anti-SGK2 Antibody

상품 한눈에 보기

Human SGK2 단백질을 인식하는 폴리클로날 토끼 항체로, 세럼/글루코코르티코이드 조절 키나아제 2 연구용. Affinity purification 방식으로 고순도 확보. ICC 등 다양한 응용에 적합. 인간 종 특이적 반응 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011387-100 Anti-SGK2 Antibody, serum/glucocorticoid regulated kinase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011387-25 Anti-SGK2 Antibody, serum/glucocorticoid regulated kinase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: serum/glucocorticoid regulated kinase 2
Target Gene: SGK2
Verified Species Reactivity: Human
Interspecies Information:
- Rat ENSRNOG00000033573 (93%)
- Mouse ENSMUSG00000017868 (93%)

Polyclonal Antibody against Human SGK2

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPD

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	ICC (Immunocytochemistry)
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Safety Information	Material Safety Data Sheet