CacheBy
Atlas Antibodies Anti-SGK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SGK3 Antibody

상품 한눈에 보기

Human SGK3 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합함. Rabbit 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. Human에 검증된 반응성을 가지며 높은 종간 서열 유사성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027146-100 Anti-SGK3 Antibody, serum/glucocorticoid regulated kinase family, member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027146-25 Anti-SGK3 Antibody, serum/glucocorticoid regulated kinase family, member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SGK3 Antibody

Anti-SGK3 Antibody

Target: serum/glucocorticoid regulated kinase family, member 3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human SGK3.


Alternative Gene Names

  • SGK2
  • SGKL

Open Datasheet


Target Information

항목 내용
Target Protein serum/glucocorticoid regulated kinase family, member 3
Target Gene SGK3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000049052 (96%), Mouse ENSMUSG00000025915 (96%)

Antigen Sequence

DVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSY


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.