CacheBy
Atlas Antibodies Anti-SEL1L3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SEL1L3 Antibody

상품 한눈에 보기

Human SEL1L3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보존되어 안정적입니다.

카탈로그번호
HPA040045-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040045-100 Anti-SEL1L3 Antibody, sel-1 suppressor of lin-12-like 3 (C. elegans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040045-25 Anti-SEL1L3 Antibody, sel-1 suppressor of lin-12-like 3 (C. elegans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEL1L3 Antibody

Anti-SEL1L3 Antibody

Target: sel-1 suppressor of lin-12-like 3 (C. elegans)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SEL1L3 protein.

Alternative Gene Names

  • KIAA0746

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein sel-1 suppressor of lin-12-like 3 (C. elegans)
Target Gene SEL1L3
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)

Antigen Sequence:

SMNLGYKHYQGIDNYPLDWELSYAYYSNIATKTPLDQHTLQGDQAYVETIRLKDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEAA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000004932 (98%)
  • Mouse ENSMUSG00000029189 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.