CacheBy
Atlas Antibodies Anti-SEL1L3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SEL1L3 Antibody

상품 한눈에 보기

Human SEL1L3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 적용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% glycerol/PBS buffer에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA058792-100 Anti-SEL1L3 Antibody, sel-1 suppressor of lin-12-like 3 (C. elegans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058792-25 Anti-SEL1L3 Antibody, sel-1 suppressor of lin-12-like 3 (C. elegans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEL1L3 Antibody

Anti-SEL1L3 Antibody

Target: sel-1 suppressor of lin-12-like 3 (C. elegans)


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human SEL1L3


Alternative Gene Names

  • KIAA0746

Open Datasheet


Target Information

항목 내용
Target Protein sel-1 suppressor of lin-12-like 3 (C. elegans)
Target Gene SEL1L3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SMNLGYKHYQGIDNYPLDWELSYAYYSNIATKTPLDQHTLQGDQAYVETIRLKDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEAA
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004932 (98%), Mouse ENSMUSG00000029189 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.