
원본
Atlas Antibodies Anti-SEH1L Antibody
상품 한눈에 보기
Human SEH1L 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. SEC13L, SEH1A, SEH1B 등 대체 유전자명으로도 알려짐.
- 카탈로그번호
- HPA039964-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039964-100 Anti-SEH1L Antibody, SEH1-like (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039964-25 Anti-SEH1L Antibody, SEH1-like (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SEH1L Antibody
Anti-SEH1L Antibody
Target Information
- Target Protein: SEH1-like (S. cerevisiae)
- Target Gene: SEH1L
- Alternative Gene Names: SEC13L, Seh1, SEH1A, SEH1B
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human SEH1L
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
LMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQI
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000042879 | 94% |
| Mouse | ENSMUSG00000079614 | 93% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
Additional Information
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



