CacheBy
Atlas Antibodies Anti-SCIN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCIN Antibody

상품 한눈에 보기

인간 SCIN 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원으로 정제되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품입니다.

카탈로그번호
HPA024264-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024264-100 Anti-SCIN Antibody, scinderin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024264-25 Anti-SCIN Antibody, scinderin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCIN Antibody

Anti-SCIN Antibody

Target: scinderin
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human SCIN


Alternative Gene Names

  • adseverin
  • KIAA1905

Open Datasheet (PDF)


Antigen Information

Target Protein: scinderin
Target Gene: SCIN
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LKANQVATGIRYNERKGRSELIVVEEGSEPSELIKVLGEKPELPDGGDDDDIIADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHG

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000002565 87%
Rat ENSRNOG00000004498 87%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Glycerol 40%
PBS pH 7.2
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.