CacheBy
Atlas Antibodies Anti-SCLT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCLT1 Antibody

상품 한눈에 보기

인간 SCLT1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대한 반응성이 검증되었으며, 40% glycerol/PBS 완충액에 보존되어 있습니다.

카탈로그번호
HPA036561-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036561-100 Anti-SCLT1 Antibody, sodium channel and clathrin linker 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036561-25 Anti-SCLT1 Antibody, sodium channel and clathrin linker 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCLT1 Antibody

Anti-SCLT1 Antibody

Target: Sodium channel and clathrin linker 1 (SCLT1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human SCLT1 protein.

Alternative Gene Names

FLJ30655, hCAP-1A

Open Datasheet


Target Information

  • Target Protein: Sodium channel and clathrin linker 1
  • Target Gene: SCLT1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
STMEHEFSIKERGFEVQLREMEDSNRNSIVELRHLLATQQKAANRWKEETKKLTESAEIRINNLKSELSRQKLHTQELLSQLEMANEK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000059834): 92%
  • Rat (ENSRNOG00000014139): 92%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

본 항체는 면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.