CacheBy
Atlas Antibodies Anti-SCLT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCLT1 Antibody

상품 한눈에 보기

Human SCLT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 가짐. 40% glycerol 기반 버퍼에 보존 처리되어 안정적 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036560-100 Anti-SCLT1 Antibody, sodium channel and clathrin linker 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036560-25 Anti-SCLT1 Antibody, sodium channel and clathrin linker 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCLT1 Antibody

Anti-SCLT1 Antibody

Target: Sodium Channel and Clathrin Linker 1 (SCLT1)
Type: Polyclonal Antibody against Human SCLT1


  • Immunohistochemistry (IHC)

Product Description

Rabbit polyclonal antibody raised against human SCLT1 (Sodium Channel and Clathrin Linker 1).


Alternative Gene Names

  • FLJ30655
  • hCAP-1A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Sodium Channel and Clathrin Linker 1
Target Gene SCLT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence STMEHEFSIKERGFEVQLREMEDSNRNSIVELRHLLATQQKAANRWKEETKKLTESAEIRINNLKSELSRQKLHTQELLSQLEMANEK
Verified Species Reactivity Human
Interspecies Identity Mouse (92%), Rat (92%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.