CacheBy
Atlas Antibodies Anti-SCG5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCG5 Antibody

상품 한눈에 보기

Human SCG5 단백질을 인식하는 Polyclonal 항체로, IHC Orthogonal 검증 완료. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 Affinity 정제됨. 다양한 조직에서 RNA-seq 데이터 기반 단백질 발현 비교 검증 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA013136-100 Anti-SCG5 Antibody, secretogranin V (7B2 protein) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013136-25 Anti-SCG5 Antibody, secretogranin V (7B2 protein) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCG5 Antibody

Anti-SCG5 Antibody

Target: secretogranin V (7B2 protein)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SCG5

Alternative Gene Names

7B2, SGNE1, SgV

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein secretogranin V (7B2 protein)
Target Gene SCG5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000007542 (96%), Mouse ENSMUSG00000023236 (96%)

Antigen Sequence:
EGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.