
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DPP10 Antibody
상품 한눈에 보기
Human DPP10 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit IgG 형식이며 PrEST 항원으로 정제됨. 인간에 대해 검증된 반응성을 가지며, glycerol/PBS 완충액에 보존됨. DPRP3 대체 유전자명으로도 알려짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048767-100 Anti-DPP10 Antibody, dipeptidyl-peptidase 10 (non-functional) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048767-25 Anti-DPP10 Antibody, dipeptidyl-peptidase 10 (non-functional) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DPP10 Antibody
Anti-DPP10 Antibody
Target Protein: dipeptidyl-peptidase 10 (non-functional)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human DPP10
Alternative Gene Names: DPRP3
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dipeptidyl-peptidase 10 (non-functional) |
| Target Gene | DPP10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000036815 (83%), Rat ENSRNOG00000002595 (82%) |
Antigen Sequence:
GLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKK
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



