
원본
Atlas Antibodies Anti-DIRAS3 Antibody
상품 한눈에 보기
Human DIRAS3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB(재조합 발현) 검증 완료. ARHI/NOEY2 유전자 대체명으로 알려짐. PrEST 항원으로 친화 정제된 고품질 연구용 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028557-100 Anti-DIRAS3 Antibody, DIRAS family, GTP-binding RAS-like 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028557-25 Anti-DIRAS3 Antibody, DIRAS family, GTP-binding RAS-like 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DIRAS3 Antibody
Anti-DIRAS3 Antibody
DIRAS family, GTP-binding RAS-like 3
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human DIRAS3.
Alternative Gene Names
ARHI, NOEY2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DIRAS family, GTP-binding RAS-like 3 |
| Target Gene | DIRAS3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (45%), Mouse (45%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Antigen Sequence
SDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



