
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DIRC2 Antibody
상품 한눈에 보기
Human DIRC2 단백질을 인식하는 Rabbit Polyclonal Antibody로, renal carcinoma 관련 연구에 적합함. Recombinant PrEST 항원으로 제작되어 높은 특이성 보유. Human 종에 검증되었으며 Mouse, Rat에서도 높은 서열 유사성(92%)을 가짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA072579-100 Anti-DIRC2 Antibody, disrupted in renal carcinoma 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072579-25 Anti-DIRC2 Antibody, disrupted in renal carcinoma 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DIRC2 Antibody
Anti-DIRC2 Antibody
Target: disrupted in renal carcinoma 2 (DIRC2)
Supplier: Atlas Antibodies
Recommended Applications
Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human DIRC2
Alternative Gene Names
- FLJ14784
- RCC4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | disrupted in renal carcinoma 2 |
| Target Gene | DIRC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000022848 (92%), Rat ENSRNOG00000002240 (92%) |
Antigen Sequence:
IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



