CacheBy
Atlas Antibodies Anti-DIRC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DIRC1 Antibody

상품 한눈에 보기

Human DIRC1 단백질을 인식하는 토끼 폴리클로날 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 반응성이 검증된 연구용 시약입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068508-100 Anti-DIRC1 Antibody, disrupted in renal carcinoma 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068508-25 Anti-DIRC1 Antibody, disrupted in renal carcinoma 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DIRC1 Antibody

Anti-DIRC1 Antibody

Target: Disrupted in renal carcinoma 1 (DIRC1)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human DIRC1.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Disrupted in renal carcinoma 1
Target Gene DIRC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000033134 (32%), Mouse ENSMUSG00000005583 (32%)

Antigen Sequence:
EPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLS


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.