AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DHRS4 Antibody
상품 한눈에 보기
Human DHRS4 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, RNA-seq 기반 Orthogonal 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023972-100 Anti-DHRS4 Antibody, dehydrogenase/reductase (SDR family) member 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023972-25 Anti-DHRS4 Antibody, dehydrogenase/reductase (SDR family) member 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DHRS4 Antibody
Anti-DHRS4 Antibody
Target: dehydrogenase/reductase (SDR family) member 4
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against Human DHRS4.
Alternative Gene Names
FLJ11008, humNRDR, SCAD-SRL, SDR-SRL, SDR25C2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dehydrogenase/reductase (SDR family) member 4 |
| Target Gene | DHRS4 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | SIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGT |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000022210) – 75%
- Rat (ENSRNOG00000018239) – 75%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.