CacheBy
Atlas Antibodies Anti-DHTKD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DHTKD1 Antibody

상품 한눈에 보기

Human DHTKD1 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형태입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. PBS 및 글리세롤 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037950-100 Anti-DHTKD1 Antibody, dehydrogenase E1 and transketolase domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037950-25 Anti-DHTKD1 Antibody, dehydrogenase E1 and transketolase domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DHTKD1 Antibody

Anti-DHTKD1 Antibody

Target Protein: dehydrogenase E1 and transketolase domain containing 1
Target Gene: DHTKD1

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DHTKD1.

Alternative Gene Names

CMT2Q, DKFZP762M115, KIAA1630, MGC3090

Open Datasheet (PDF)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ALPLFWRGYQTERGVYGYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000062048 (80%)
  • Mouse ENSMUSG00000025815 (79%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.