CacheBy
Atlas Antibodies Anti-DHRS9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DHRS9 Antibody

상품 한눈에 보기

인간 DHRS9 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 다양한 종 간 상동성 정보 제공. 40% 글리세롤 기반 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036667-100 Anti-DHRS9 Antibody, dehydrogenase/reductase (SDR family) member 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036667-25 Anti-DHRS9 Antibody, dehydrogenase/reductase (SDR family) member 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DHRS9 Antibody

Anti-DHRS9 Antibody

Target: dehydrogenase/reductase (SDR family) member 9
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human DHRS9.


Alternative Gene Names

3alpha-HSD, RDH15, RDHL, RETSDR8, SDR9C4

Open Datasheet


Target Information

항목 내용
Target Protein dehydrogenase/reductase (SDR family) member 9
Target Gene DHRS9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGN
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000027068 (86%), Rat ENSRNOG00000058568 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.