CacheBy
Atlas Antibodies Anti-DHDDS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DHDDS Antibody

상품 한눈에 보기

Human DHDDS 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 제조됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 서열 유사성으로 Mouse 및 Rat에서도 반응 가능.

카탈로그번호
HPA026727-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026727-100 Anti-DHDDS Antibody, dehydrodolichyl diphosphate synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026727-25 Anti-DHDDS Antibody, dehydrodolichyl diphosphate synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DHDDS Antibody

Anti-DHDDS Antibody

Target Information

  • Target Protein: Dehydrodolichyl diphosphate synthase
  • Target Gene: DHDDS
  • Alternative Gene Names: DS, FLJ13102, HDS, RP59

Product Description

Polyclonal antibody against human DHDDS produced in rabbit.
Affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000012117 (91%)
  • Rat ENSRNOG00000014665 (91%)

Immunohistochemistry (IHC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen
Storage Note Gently mix before use. Determine optimal concentration per application.

Material Safety Data Sheet
Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.