CacheBy
Atlas Antibodies Anti-DHFR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DHFR2 Antibody

상품 한눈에 보기

인체 DHFR2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. 토끼에서 생산된 IgG 형 항체이며, PrEST 항원으로 정제되었습니다. 인간과 마우스, 랫에서 높은 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051465-100 Anti-DHFR2 Antibody, dihydrofolate reductase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051465-25 Anti-DHFR2 Antibody, dihydrofolate reductase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DHFR2 Antibody

Anti-DHFR2 Antibody

Target Information

  • Target Protein: Dihydrofolate reductase 2
  • Target Gene: DHFR2
  • Alternative Gene Names: DHFRL1, DHFRP4, FLJ16119
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DHFR2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PLRNEFRYFQRMTTTSSVEGKQNLVIMGRK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000021707 97%
Rat ENSRNOG00000013521 93%

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.